PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_962A9D448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 243aa    MW: 26123.1 Da    PI: 8.5852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_962A9D448.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEd++l d++ ++G  +W+t++ + g+ R +k+c++rw +yl
  Traes_2AL_962A9D448.1 15 KGLWSPEEDQKLRDYIVRYGHSCWSTVPVKAGLQRNGKSCRLRWINYL 62
                           678*******************************************97 PP

2Myb_DNA-binding50.45e-1669113248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            g ++ eE+e    +++ lG++ W+ Ia++++ gRt++++k++w++yl
  Traes_2AL_962A9D448.1  69 GMFSREEEETVMSLHATLGNK-WSQIAQHLP-GRTDNEVKNYWNSYL 113
                            56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-211065IPR009057Homeodomain-like
PROSITE profilePS5129414.2831062IPR017930Myb domain
SuperFamilySSF466895.14E-2813109IPR009057Homeodomain-like
SMARTSM007171.2E-101464IPR001005SANT/Myb domain
PfamPF002496.1E-131562IPR001005SANT/Myb domain
CDDcd001673.52E-101862No hitNo description
PROSITE profilePS5129424.25463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2566116IPR009057Homeodomain-like
SMARTSM007172.6E-1367115IPR001005SANT/Myb domain
PfamPF002495.7E-1569113IPR001005SANT/Myb domain
CDDcd001678.49E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGCKSCQKPK AQHRKGLWSP EEDQKLRDYI VRYGHSCWST VPVKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSREEEETVM SLHATLGNKW SQIAQHLPGR TDNEVKNYWN SYLKKRVEGA  120
RAPAKSAGSD APRSPTPSDS GRERSTVNQP SNSGSSGPPE SSSTADDSSS LTGPGAAGSI  180
RPHAPVLPKV MFADWLDMDM DYGAGLMAPS ALDAAFDCSP AQQGASGSTT VDGLCGAVDS  240
LQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26151187109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3705130.0AK370513.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2111O05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580215.11e-127PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K41e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLW5AV150.0W5AV15_WHEAT; Uncharacterized protein
STRINGMLOC_73614.11e-147(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.15e-62myb domain protein 19
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]